PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g09570.1
Common NameLR48_Vigan09g108400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 176aa    MW: 20074.5 Da    PI: 5.7152
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g09570.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.11.1e-192269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+++v+++G g+W+++ar  g++R +k+c++rw +yl
   Vang06g09570.1 22 KGPWTAEEDRLLIQYVRLHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 69
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-231672IPR009057Homeodomain-like
PROSITE profilePS5129425.1331773IPR017930Myb domain
SMARTSM007173.9E-172171IPR001005SANT/Myb domain
PfamPF002493.2E-182269IPR001005SANT/Myb domain
SuperFamilySSF466895.85E-232396IPR009057Homeodomain-like
CDDcd001673.68E-132469No hitNo description
Gene3DG3DSA:1.10.10.602.3E-77396IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MYWGVMAGNM GWGMIEEQGW RKGPWTAEED RLLIQYVRLH GEGRWNSVAR LAGLKRNGKS  60
CRLRWVNYLR PDLKKGQITP QEESIIQELH ARWGNRVPST SQETQEMVNM CPNTSEQQGY  120
FYSMFNVSDN VSAPESSNEE ILWDGLWNLD DVLCNFNAAS ATSKTSLHNL VTPFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-15229627100MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-134AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014513230.13e-65PREDICTED: transcription factor MYB57-like
TrEMBLA0A0L9VBI75e-66A0A0L9VBI7_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SP865e-66A0A0S3SP86_PHAAN; Uncharacterized protein
STRINGGLYMA10G33450.12e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.17e-50myb domain protein 305
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]